PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI04G21320.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 310aa    MW: 33252.1 Da    PI: 7.0209
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI04G21320.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.69.1e-161473148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT............TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg............kgRtlkqcksrwqkyl 48
                     +g+WT++Ed+llvd+v+  G+g+W++ ++  g            ++R++k+c++rw +yl
  ORUFI04G21320.1 14 KGPWTPDEDKLLVDYVQANGSGNWRLLPKLAGearvrdrwvragLNRCGKSCRLRWTNYL 73
                     79********************************************************97 PP

2Myb_DNA-binding52.21.4e-1679122146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++T+eE++ ++++++  G++ W+ Ia+ ++ gRt++++k++w++
  ORUFI04G21320.1  79 RGPFTPEEHKSILQLHAIVGNK-WSMIAAQLP-GRTDNEIKNYWNT 122
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.961973IPR017930Myb domain
SuperFamilySSF466891.16E-2813120IPR009057Homeodomain-like
SMARTSM007172.8E-121375IPR001005SANT/Myb domain
PfamPF002494.8E-151473IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-221580IPR009057Homeodomain-like
CDDcd001677.82E-91673No hitNo description
PROSITE profilePS5129425.33574128IPR017930Myb domain
SMARTSM007171.3E-1478126IPR001005SANT/Myb domain
PfamPF002491.3E-1479122IPR001005SANT/Myb domain
CDDcd001671.66E-1081124No hitNo description
Gene3DG3DSA:1.10.10.608.0E-2681128IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MGRTPCCDSK VLKKGPWTPD EDKLLVDYVQ ANGSGNWRLL PKLAGEARVR DRWVRAGLNR  60
CGKSCRLRWT NYLRPDIKRG PFTPEEHKSI LQLHAIVGNK WSMIAAQLPG RTDNEIKNYW  120
NTNVKKQLRQ GQAAAVGEQA ALASLGGGAA SCPAARHMAQ WETARLEAEA RLSLLSGTTS  180
VATASVAASS SSSSTAAAGG AEAPPDIYLR LWNSEVGDSF RKSARSAARE DQEPANASDE  240
AAPVSATFAR PGDDSSAASN VTAAAAADEY QVFLDLAAED FELFHGRHGG FPLFPAVDML  300
GETSLYTAFD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-27121285108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL6630060.0AL663006.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBb0039L24, complete sequence.
GenBankAP0149600.0AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015636233.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLA0A0E0H3J00.0A0A0E0H3J0_ORYNI; Uncharacterized protein
TrEMBLA0A0E0PBZ30.0A0A0E0PBZ3_ORYRU; Uncharacterized protein
STRINGLOC_Os04g45060.10.0(Oryza sativa Japonica Group)
STRINGORGLA04G0169000.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54093157
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.18e-63myb domain protein 17